(data stored in ACNUC7421 zone)

EMBL: CP000094.PE374

CP000094.PE374       Location/Qualifiers
FT   CDS             431365..432324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0376"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72120"
FT                   /db_xref="GOA:Q3KJD6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD6"
FT                   /protein_id="ABA72120.1"
FT                   /translation="MKQKKAQWPWHVLTVLVLVGLAGALYYATSLMSYEWRWNRVPQYF
FT                   AYQAEETQRATDISTVSELVRKGGSAQVTLRNDAGDEQHLTVDENSLQFAQGDDVAEGD
FT                   VVGVTRHWAAGPLLWGLWTTLWLSVVSGVLGLLIGLATGLCRLSSNPTLRDLSTIYVEL
FT                   VRGTPLLVQIFIFYFFIGTVMNLSREFAGIAALSLFTGAYVAEIIRSGVQSIARGQNEA
FT                   ARSLGLSAGQSMRHVVLPQAFKRVLPPLAGQFISLVKDTSLVSVIAITELLKSGREVIT
FT                   TSFSPFEILFCVAGLYLLINLPLSKIASRLERRLAQSD"
     MKQKKAQWPW HVLTVLVLVG LAGALYYATS LMSYEWRWNR VPQYFAYQAE ETQRATDIST        60
     VSELVRKGGS AQVTLRNDAG DEQHLTVDEN SLQFAQGDDV AEGDVVGVTR HWAAGPLLWG       120
     LWTTLWLSVV SGVLGLLIGL ATGLCRLSSN PTLRDLSTIY VELVRGTPLL VQIFIFYFFI       180
     GTVMNLSREF AGIAALSLFT GAYVAEIIRS GVQSIARGQN EAARSLGLSA GQSMRHVVLP       240
     QAFKRVLPPL AGQFISLVKD TSLVSVIAIT ELLKSGREVI TTSFSPFEIL FCVAGLYLLI       300
     NLPLSKIASR LERRLAQSD                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page