(data stored in ACNUC7421 zone)

EMBL: CP000094.PE375

CP000094.PE375       Location/Qualifiers
FT   CDS             432317..433051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0377"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72121"
FT                   /db_xref="GOA:Q3KJD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJD5"
FT                   /protein_id="ABA72121.1"
FT                   /translation="MIEVRDLVKVFDTRGQVVRAVDNVSTRVAKGEVLVVIGPSGSGKS
FT                   TFLRCLNGLEEFDSGSVSIDGLQLADPKTDVNAYRREVGMVFQHFNLFPHMTVLENLCL
FT                   AQKVVRKRGQKESEAKALALLEKVGIAQKAREYPSRLSGGQQQRVAIARALAMDPKVML
FT                   FDEPTSALDPEMVGEVLDVMKNLAVEGMTMVCVTHEMGFAREVADRVLFFDHGKLLEDA
FT                   SPAEFFDAPKDPRAQAFLRQVL"
     MIEVRDLVKV FDTRGQVVRA VDNVSTRVAK GEVLVVIGPS GSGKSTFLRC LNGLEEFDSG        60
     SVSIDGLQLA DPKTDVNAYR REVGMVFQHF NLFPHMTVLE NLCLAQKVVR KRGQKESEAK       120
     ALALLEKVGI AQKAREYPSR LSGGQQQRVA IARALAMDPK VMLFDEPTSA LDPEMVGEVL       180
     DVMKNLAVEG MTMVCVTHEM GFAREVADRV LFFDHGKLLE DASPAEFFDA PKDPRAQAFL       240
     RQVL                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page