(data stored in ACNUC7421 zone)

EMBL: CP000094.PE383

CP000094.PE383       Location/Qualifiers
FT   CDS             complement(438453..440057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0385"
FT                   /product="putative ubiquinone biosynthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72129"
FT                   /db_xref="GOA:Q3KJC7"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJC7"
FT                   /protein_id="ABA72129.1"
FT                   /translation="MKLLAVRRLLRIQRVVIRYRLDDLLFDLPLPWFLLALRYVLPWRW
FT                   FPRKPLELSRGARLRLALQDLGPIFIKFGQILSTRRDLLPEDIADELMRLQDRVPPFDS
FT                   QLSVKLIEEQLGKKISEVFSRFDVEPLASASVAQVHAAQLKTGEEVVVKVIRPGLKPII
FT                   AQDLAWLFILARAAEKVSADARLLHPVDVVSDYEKTIYDELDLLREAANASQLKRNFEG
FT                   SPLLYVPQVYWDWCRPKVLVMERIYGIQVTDLATLADQRTDMKMLAERGVEIFFTQVFR
FT                   DSFFHADMHPGNIFVSTVNPWSPQYIAIDCGIVGSLTPEDQDYLARNLFAFFKRDYRRV
FT                   AQLHIDSGWVPAETKLNEFEAAIRTVCEPIFEKPLKDISFGQVLMRLFQTARRFNMEVQ
FT                   PQLVLLQKTLLNIEGLGRQLYPDLDLWNTAQPFLERWMRERVSPKALLGNVQSQFEQLP
FT                   HLANMARDLLERMSQPHANDPPPPWKKRKDDWFLRLLGSAHLAGGTILAAGGPLHELGH
FT                   WPAGIMVAVGLYLVVRR"
     MKLLAVRRLL RIQRVVIRYR LDDLLFDLPL PWFLLALRYV LPWRWFPRKP LELSRGARLR        60
     LALQDLGPIF IKFGQILSTR RDLLPEDIAD ELMRLQDRVP PFDSQLSVKL IEEQLGKKIS       120
     EVFSRFDVEP LASASVAQVH AAQLKTGEEV VVKVIRPGLK PIIAQDLAWL FILARAAEKV       180
     SADARLLHPV DVVSDYEKTI YDELDLLREA ANASQLKRNF EGSPLLYVPQ VYWDWCRPKV       240
     LVMERIYGIQ VTDLATLADQ RTDMKMLAER GVEIFFTQVF RDSFFHADMH PGNIFVSTVN       300
     PWSPQYIAID CGIVGSLTPE DQDYLARNLF AFFKRDYRRV AQLHIDSGWV PAETKLNEFE       360
     AAIRTVCEPI FEKPLKDISF GQVLMRLFQT ARRFNMEVQP QLVLLQKTLL NIEGLGRQLY       420
     PDLDLWNTAQ PFLERWMRER VSPKALLGNV QSQFEQLPHL ANMARDLLER MSQPHANDPP       480
     PPWKKRKDDW FLRLLGSAHL AGGTILAAGG PLHELGHWPA GIMVAVGLYL VVRR             534
//

If you have problems or comments...

PBIL Back to PBIL home page