(data stored in ACNUC7421 zone)

EMBL: CP000094.PE387

CP000094.PE387       Location/Qualifiers
FT   CDS             442050..442472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0389"
FT                   /product="putative polyhydroxyalkanoate
FT                   biosynthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72133"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJC3"
FT                   /protein_id="ABA72133.1"
FT                   /translation="MAKVILKKKIDASTSALSDVKSYARKIWLAGLGAYTKVGQEGSEY
FT                   FQELIKAGQTVEKKGKKAVTEKLEAANAEIDEAKSEVSSFKGRVEVQLDKVEKAFDTRV
FT                   ASALNRIGIPSKHDVEALSAKLDELTALLERVARKS"
     MAKVILKKKI DASTSALSDV KSYARKIWLA GLGAYTKVGQ EGSEYFQELI KAGQTVEKKG        60
     KKAVTEKLEA ANAEIDEAKS EVSSFKGRVE VQLDKVEKAF DTRVASALNR IGIPSKHDVE       120
     ALSAKLDELT ALLERVARKS                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page