(data stored in ACNUC7421 zone)

EMBL: CP000094.PE389

CP000094.PE389       Location/Qualifiers
FT   CDS             complement(443464..444084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0391"
FT                   /product="putative TetR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72135"
FT                   /db_xref="GOA:Q3KJC1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJC1"
FT                   /protein_id="ABA72135.1"
FT                   /translation="MKTSERILECALQLFNEKGEPNVSTMEVANEMGISPGNLYYHFHG
FT                   KEPLILGLFERFQNDLAPLLDPPADVELAPEDYWLFLHLIVERLAQYRFLFQDLSNLAG
FT                   RLPKLAKGIRQFLNVLKRTLASLLARLKASGQLVSDTQALGQLVEQITMTLLFSLDYQR
FT                   ILDREGEVRLVVYQIMMLVAPHLLPPVKVATERMALQYLEDHE"
     MKTSERILEC ALQLFNEKGE PNVSTMEVAN EMGISPGNLY YHFHGKEPLI LGLFERFQND        60
     LAPLLDPPAD VELAPEDYWL FLHLIVERLA QYRFLFQDLS NLAGRLPKLA KGIRQFLNVL       120
     KRTLASLLAR LKASGQLVSD TQALGQLVEQ ITMTLLFSLD YQRILDREGE VRLVVYQIMM       180
     LVAPHLLPPV KVATERMALQ YLEDHE                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page