(data stored in ACNUC7421 zone)

EMBL: CP000094.PE394

CP000094.PE394       Location/Qualifiers
FT   CDS             complement(449262..450599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0396"
FT                   /product="ATP-dependent hsl protease ATP-binding subunit
FT                   hslu"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72140"
FT                   /db_xref="GOA:Q3KJB6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJB6"
FT                   /protein_id="ABA72140.1"
FT                   /translation="MSMTPREIVHELNRHIIGQDDAKRAVAIALRNRWRRMQLPEELRV
FT                   EVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGRDVESIIRDLAD
FT                   AAIKMLREQEMTRVRHRAEDAAEDRILDALLPPARMGFSNEEAPTQDSNTRQLFRKRLR
FT                   EGQLDDKEIEIEVAEMAGIEIATPPGMEEMTNQLQNLFANMGKGKKKARKLKVKEALKL
FT                   VRDEEAGRLVNEEELKAKALEAVEQHGIVFIDEIDKVAKRGNVGGADVSREGVQRDLLP
FT                   LIEGCTVNTKLGMVKTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELKALSPQDFER
FT                   ILSEPHASLTEQYCALLKTEGLNIQFQPEGIKRLAEIAWQVNEKTENIGARRLHTLLER
FT                   LLEEVSFSAGDLASAHDDKAIQIDAEYVNSHLGELAQNEDLSRYIL"
     MSMTPREIVH ELNRHIIGQD DAKRAVAIAL RNRWRRMQLP EELRVEVTPK NILMIGPTGV        60
     GKTEIARRLA KLANAPFIKV EATKFTEVGY VGRDVESIIR DLADAAIKML REQEMTRVRH       120
     RAEDAAEDRI LDALLPPARM GFSNEEAPTQ DSNTRQLFRK RLREGQLDDK EIEIEVAEMA       180
     GIEIATPPGM EEMTNQLQNL FANMGKGKKK ARKLKVKEAL KLVRDEEAGR LVNEEELKAK       240
     ALEAVEQHGI VFIDEIDKVA KRGNVGGADV SREGVQRDLL PLIEGCTVNT KLGMVKTDHI       300
     LFIASGAFHL SKPSDLVPEL QGRLPIRVEL KALSPQDFER ILSEPHASLT EQYCALLKTE       360
     GLNIQFQPEG IKRLAEIAWQ VNEKTENIGA RRLHTLLERL LEEVSFSAGD LASAHDDKAI       420
     QIDAEYVNSH LGELAQNEDL SRYIL                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page