(data stored in ACNUC7421 zone)

EMBL: CP000094.PE396

CP000094.PE396       Location/Qualifiers
FT   CDS             complement(451341..452057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72142"
FT                   /db_xref="GOA:Q3KJB4"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJB4"
FT                   /protein_id="ABA72142.1"
FT                   /translation="MAAKKKPAPKRGASRYQAPAKQPIPGWLWMAIGLTVGAFIVFLMK
FT                   LEPGKGSDTVKREKIEQQQQQKATKIAEANKTPPSPTQPVKPKYDFYTLLPESEVIVPP
FT                   DAVPEKTLPTPQVPAIPTTPVTPAEAAKIDTARAQAALAGITPPPAPPVTKAAPVTKFF
FT                   LQAGSFRKETDADKVRAQIILLGQAVAVESGTVKDETWYRVLVGPFSNREQLTTAQKQL
FT                   AGAGFSNLLLQQRQSR"
     MAAKKKPAPK RGASRYQAPA KQPIPGWLWM AIGLTVGAFI VFLMKLEPGK GSDTVKREKI        60
     EQQQQQKATK IAEANKTPPS PTQPVKPKYD FYTLLPESEV IVPPDAVPEK TLPTPQVPAI       120
     PTTPVTPAEA AKIDTARAQA ALAGITPPPA PPVTKAAPVT KFFLQAGSFR KETDADKVRA       180
     QIILLGQAVA VESGTVKDET WYRVLVGPFS NREQLTTAQK QLAGAGFSNL LLQQRQSR         238
//

If you have problems or comments...

PBIL Back to PBIL home page