(data stored in ACNUC7421 zone)

EMBL: CP000094.PE41

CP000094.PE41        Location/Qualifiers
FT   CDS             complement(44669..45898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71785"
FT                   /db_xref="GOA:Q3KKC1"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKC1"
FT                   /protein_id="ABA71785.1"
FT                   /translation="MLNGLWLGFFVVAAVSALGQWLIGGNAGIFAAMVESIFAMAKLSV
FT                   EVMVLLFGTLTLWLGFLRIAEKAGIVEWLAKVLGPLFLRLMPEVPAGHPALGLITLNFA
FT                   ANGLGLDNAATPIGLKAMKALQELNPSSTIASNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGAPDPTLVFLPILLATSCSTIVGFLSVAFMQRLRVWDPVVLAYLIPGALILGGFMALL
FT                   ATMSATALAGLSSILGNLTLFGLIMLFLVIGALRKVKVYEAFVEGAKEGFDVAKNLLPY
FT                   LVAMLCAIGVLRASGALDFGLDGIRHLVEWAGWDTRFVDALPTAMVKPFSGSAARAMLI
FT                   ETMKTSGVDSFPALVAATIQGSTETTFYVLAVYFGAVGIQRARHAVGCALLAELAGVLG
FT                   AIGVCYWFFG"
     MLNGLWLGFF VVAAVSALGQ WLIGGNAGIF AAMVESIFAM AKLSVEVMVL LFGTLTLWLG        60
     FLRIAEKAGI VEWLAKVLGP LFLRLMPEVP AGHPALGLIT LNFAANGLGL DNAATPIGLK       120
     AMKALQELNP SSTIASNAQI LFLVLNASSL TLLPVTIFMY RAQQGAPDPT LVFLPILLAT       180
     SCSTIVGFLS VAFMQRLRVW DPVVLAYLIP GALILGGFMA LLATMSATAL AGLSSILGNL       240
     TLFGLIMLFL VIGALRKVKV YEAFVEGAKE GFDVAKNLLP YLVAMLCAIG VLRASGALDF       300
     GLDGIRHLVE WAGWDTRFVD ALPTAMVKPF SGSAARAMLI ETMKTSGVDS FPALVAATIQ       360
     GSTETTFYVL AVYFGAVGIQ RARHAVGCAL LAELAGVLGA IGVCYWFFG                   409
//

If you have problems or comments...

PBIL Back to PBIL home page