(data stored in ACNUC7421 zone)

EMBL: CP000094.PE410

CP000094.PE410       Location/Qualifiers
FT   CDS             468333..469934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0412"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72156"
FT                   /db_xref="GOA:Q3KJA0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJA0"
FT                   /protein_id="ABA72156.1"
FT                   /translation="MTSLHADEAFLGHFQLSHDPFAPRVPGFKFFPAQRKPVLGQLHHL
FT                   ARYSQLLLVVTGPQGSGKTLLRQALVASTNKQSVQSVVVSARGAGDAAGVLRQIAQALD
FT                   VAQAEVGAILDQVVQLALTGQEVYLLVDDAEQLDESALEALMALGAGAPEGRPHVFLFG
FT                   ESSLIAQLEALHLEEERFHVIELQPYTEEETREYLDQRLEGAGRGVELFTADQISDIHE
FT                   SSEGWPGNINQVARDALIEVMIASRSAVKRPSMGFNMPKKHVLAISAVVVVAVAAAWLM
FT                   PGRNKAPTTGAPANEQAQLPLGQGAPQAGGAPSVEFNGNTQPMPLPLVGNSQPVMRGPL
FT                   AEAAGGITEGDDGVPVEGSSNTPPTVTTTAPPAGVQAGPAPTPVPVPVPAAKPTPAPTQ
FT                   VATAKPAPAAPVAKPAPAPAKPVAAAKPAEKPVTVAKAAGGSWYAGQPTSNYVVQILGT
FT                   SSEATAQNFVKEQGGEYRYFKKVLNGKPLYVITYGNFANRDAAVSAIKALPAKVQAGKP
FT                   WPRTVASVQQELATTR"
     MTSLHADEAF LGHFQLSHDP FAPRVPGFKF FPAQRKPVLG QLHHLARYSQ LLLVVTGPQG        60
     SGKTLLRQAL VASTNKQSVQ SVVVSARGAG DAAGVLRQIA QALDVAQAEV GAILDQVVQL       120
     ALTGQEVYLL VDDAEQLDES ALEALMALGA GAPEGRPHVF LFGESSLIAQ LEALHLEEER       180
     FHVIELQPYT EEETREYLDQ RLEGAGRGVE LFTADQISDI HESSEGWPGN INQVARDALI       240
     EVMIASRSAV KRPSMGFNMP KKHVLAISAV VVVAVAAAWL MPGRNKAPTT GAPANEQAQL       300
     PLGQGAPQAG GAPSVEFNGN TQPMPLPLVG NSQPVMRGPL AEAAGGITEG DDGVPVEGSS       360
     NTPPTVTTTA PPAGVQAGPA PTPVPVPVPA AKPTPAPTQV ATAKPAPAAP VAKPAPAPAK       420
     PVAAAKPAEK PVTVAKAAGG SWYAGQPTSN YVVQILGTSS EATAQNFVKE QGGEYRYFKK       480
     VLNGKPLYVI TYGNFANRDA AVSAIKALPA KVQAGKPWPR TVASVQQELA TTR              533
//

If you have problems or comments...

PBIL Back to PBIL home page