(data stored in ACNUC7421 zone)

EMBL: CP000094.PE414

CP000094.PE414       Location/Qualifiers
FT   CDS             complement(477548..478822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0416"
FT                   /product="putative transport-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72160"
FT                   /db_xref="GOA:Q3KJ96"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ96"
FT                   /protein_id="ABA72160.1"
FT                   /translation="MKTAVAPLAHEVPPAAADDVMTELQEIYIEKGTPAFMRTVLALFS
FT                   GGFATFALLYCVQPMMPLLSHEYSINAAQSSLILSVATGMLAFGLLITGPISDRVGRKP
FT                   VMVAALFAAALCTIASSMMPSWHGVLIMRALIGLSLSGLAAVAMTYLSEEIHPQHIGLA
FT                   MGLYIGGNAIGGMSGRLITGVLIDFVSWHTAMMVIGGLALIAAAVFWKILPESRNFRSR
FT                   SLHPRSLLDGFTMHFRDAGLPLLFLEAFVLMGAFVTLFNYIGYRLLAEPYHMDQVFVGL
FT                   LSVVYLSGIYSSAKIGSLADKLGRRKVLWATIALMFAGLALTMFTPLPLVIIGMLIFTF
FT                   GFFGAHSVASSWIGRRALKAKGQASSLYLFSYYAGSSIAGTAGGVFWHMAGWNGIGLFI
FT                   GALLLVALLVALKLAKLPPLGGVKA"
     MKTAVAPLAH EVPPAAADDV MTELQEIYIE KGTPAFMRTV LALFSGGFAT FALLYCVQPM        60
     MPLLSHEYSI NAAQSSLILS VATGMLAFGL LITGPISDRV GRKPVMVAAL FAAALCTIAS       120
     SMMPSWHGVL IMRALIGLSL SGLAAVAMTY LSEEIHPQHI GLAMGLYIGG NAIGGMSGRL       180
     ITGVLIDFVS WHTAMMVIGG LALIAAAVFW KILPESRNFR SRSLHPRSLL DGFTMHFRDA       240
     GLPLLFLEAF VLMGAFVTLF NYIGYRLLAE PYHMDQVFVG LLSVVYLSGI YSSAKIGSLA       300
     DKLGRRKVLW ATIALMFAGL ALTMFTPLPL VIIGMLIFTF GFFGAHSVAS SWIGRRALKA       360
     KGQASSLYLF SYYAGSSIAG TAGGVFWHMA GWNGIGLFIG ALLLVALLVA LKLAKLPPLG       420
     GVKA                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page