(data stored in ACNUC7421 zone)

EMBL: CP000094.PE416

CP000094.PE416       Location/Qualifiers
FT   CDS             complement(479838..480275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ94"
FT                   /protein_id="ABA72162.1"
FT                   /translation="MQAKALIAAALFSLLPSASHATNLMYMPFETVVSDAMRAGRLDGS
FT                   VKFYLVGNGPQGTQRLLQRGVVSDLKTNGFNKSDHDSCEWVLQSNLIALQAEAKRVGAN
FT                   AVTNIVSYYDQHVRKDLNTYECRAGIFVTRVALKGDLVRLP"
     MQAKALIAAA LFSLLPSASH ATNLMYMPFE TVVSDAMRAG RLDGSVKFYL VGNGPQGTQR        60
     LLQRGVVSDL KTNGFNKSDH DSCEWVLQSN LIALQAEAKR VGANAVTNIV SYYDQHVRKD       120
     LNTYECRAGI FVTRVALKGD LVRLP                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page