(data stored in ACNUC7421 zone)

EMBL: CP000094.PE418

CP000094.PE418       Location/Qualifiers
FT   CDS             480696..480983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0420"
FT                   /product="putative phage DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72164"
FT                   /db_xref="GOA:Q3KJ92"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ92"
FT                   /protein_id="ABA72164.1"
FT                   /translation="MTEQFTRWDSAEYLKTEEDMANYLDACMEEAGDDPAFIAKALGTI
FT                   ARARGMTQVARDAGLSRESLYRALSGEVNPEFGTILKVMKALGLKLHAST"
     MTEQFTRWDS AEYLKTEEDM ANYLDACMEE AGDDPAFIAK ALGTIARARG MTQVARDAGL        60
     SRESLYRALS GEVNPEFGTI LKVMKALGLK LHAST                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page