(data stored in ACNUC7421 zone)

EMBL: CP000094.PE419

CP000094.PE419       Location/Qualifiers
FT   CDS             complement(481032..481472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72165"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ91"
FT                   /protein_id="ABA72165.1"
FT                   /translation="MHFKKLAATLLICAMPAVSQARDTAVYLPFDKAVAEATRTGKIDG
FT                   SVKFYLAGNAPAGKVTVVSPGAVTNKKTNAFNKTDQEACEWVVQSAIISLHQAAKNAGA
FT                   NAVTNIVSFYKSNERKDAKTYECHAGAIMAGVALKGDLATVQ"
     MHFKKLAATL LICAMPAVSQ ARDTAVYLPF DKAVAEATRT GKIDGSVKFY LAGNAPAGKV        60
     TVVSPGAVTN KKTNAFNKTD QEACEWVVQS AIISLHQAAK NAGANAVTNI VSFYKSNERK       120
     DAKTYECHAG AIMAGVALKG DLATVQ                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page