(data stored in ACNUC7421 zone)

EMBL: CP000094.PE421

CP000094.PE421       Location/Qualifiers
FT   CDS             complement(482728..483456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0423"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72167"
FT                   /db_xref="GOA:Q3KJ89"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ89"
FT                   /protein_id="ABA72167.1"
FT                   /translation="MTESILVTGSSRGIGRAIALRLASAGHDIVLHCRSGVTEAQAVKA
FT                   EVEALGRTARILQFDVADRETCKAILEADVEAHGAYYGVVLNAGLTRDGAFPALSDDDW
FT                   DVVLRTNLDGFYNVLHPVMMPMIRRRAAGRIVCITSVSGLIGNRGQVNYSASKAGVIGA
FT                   AKALAIELAKRKITVNCVAPGLIDTAMLDENVPVEELLKMIPAQRMGTPEEVAGAVNFL
FT                   MSAEASYITRQVLAVNGGLC"
     MTESILVTGS SRGIGRAIAL RLASAGHDIV LHCRSGVTEA QAVKAEVEAL GRTARILQFD        60
     VADRETCKAI LEADVEAHGA YYGVVLNAGL TRDGAFPALS DDDWDVVLRT NLDGFYNVLH       120
     PVMMPMIRRR AAGRIVCITS VSGLIGNRGQ VNYSASKAGV IGAAKALAIE LAKRKITVNC       180
     VAPGLIDTAM LDENVPVEEL LKMIPAQRMG TPEEVAGAVN FLMSAEASYI TRQVLAVNGG       240
     LC                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page