(data stored in ACNUC7421 zone)

EMBL: CP000094.PE428

CP000094.PE428       Location/Qualifiers
FT   CDS             complement(488698..491031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0430"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72174"
FT                   /db_xref="GOA:Q3KJ82"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ82"
FT                   /protein_id="ABA72174.1"
FT                   /translation="MPSERRLPWLFLILLLAVVALGAWQWRDGAPLSANLMELVPGTHP
FT                   DALELRAEQRMQEPLNRDMLVLVGHTDRQQAVAMAQTLGEQWQASGLFEKVQWNLQADL
FT                   PALRTQLLQGRLAMLSADDRQLLIEHPDAFIQQRVQALFDPFTGFSLVPSQDDWLGLTG
FT                   RIQNSQPQHGAVQLDIGSGALIADADGKSWVLLRARTTGSAFDMNQPLQVAALLQHSRE
FT                   QAASADVQLLAASGLLYAANGQQQATREMTWVGGGATIGILLLLLLAFRRWRVLLAFIP
FT                   VLVGMLFGAVACVALFGHMHVMTLVLGSSLIGVAVDYPLHYLSKSWSLKPWHSWPALRL
FT                   TLSGLTLSLITSAIGYLALAWTPFPALTQIAVFSAAGLLGAYLSAVCLLPALLKNVELR
FT                   PAQWPLQLAERLVRLRETLLEHVRTPVLLALLIAFCVGGLLQLESKNDIRQWVGAPQRL
FT                   TDEAQTIARMTGYQPTSQFFLVRAADQQQLLERQAALSERLDQLVNLDKLQGYLALNQL
FT                   VSPPAQQQQVREALSKLPQFWQPLLEVGVPLAALQTELQQLQALPAEDIDAALAGPLGE
FT                   PYRTLWLGPTEDGVAAMVSLQGLNNPSLLRVQALDLPGVMLVDRLGDLNKVFAQTQISA
FT                   AELKLASCVLIVLVLMLPFGLGGALRIVALPLLAALCSLASLGWLGQPLTLFSLFGLLL
FT                   VTAISVDYAILMREQVGGAAVSLLGTLLAAATTWLSFGLLAVSSTPAVSNFGLSVSLGL
FT                   AFSFMLAPWAGRQPHAVAVTEPAA"
     MPSERRLPWL FLILLLAVVA LGAWQWRDGA PLSANLMELV PGTHPDALEL RAEQRMQEPL        60
     NRDMLVLVGH TDRQQAVAMA QTLGEQWQAS GLFEKVQWNL QADLPALRTQ LLQGRLAMLS       120
     ADDRQLLIEH PDAFIQQRVQ ALFDPFTGFS LVPSQDDWLG LTGRIQNSQP QHGAVQLDIG       180
     SGALIADADG KSWVLLRART TGSAFDMNQP LQVAALLQHS REQAASADVQ LLAASGLLYA       240
     ANGQQQATRE MTWVGGGATI GILLLLLLAF RRWRVLLAFI PVLVGMLFGA VACVALFGHM       300
     HVMTLVLGSS LIGVAVDYPL HYLSKSWSLK PWHSWPALRL TLSGLTLSLI TSAIGYLALA       360
     WTPFPALTQI AVFSAAGLLG AYLSAVCLLP ALLKNVELRP AQWPLQLAER LVRLRETLLE       420
     HVRTPVLLAL LIAFCVGGLL QLESKNDIRQ WVGAPQRLTD EAQTIARMTG YQPTSQFFLV       480
     RAADQQQLLE RQAALSERLD QLVNLDKLQG YLALNQLVSP PAQQQQVREA LSKLPQFWQP       540
     LLEVGVPLAA LQTELQQLQA LPAEDIDAAL AGPLGEPYRT LWLGPTEDGV AAMVSLQGLN       600
     NPSLLRVQAL DLPGVMLVDR LGDLNKVFAQ TQISAAELKL ASCVLIVLVL MLPFGLGGAL       660
     RIVALPLLAA LCSLASLGWL GQPLTLFSLF GLLLVTAISV DYAILMREQV GGAAVSLLGT       720
     LLAAATTWLS FGLLAVSSTP AVSNFGLSVS LGLAFSFMLA PWAGRQPHAV AVTEPAA          777
//

If you have problems or comments...

PBIL Back to PBIL home page