(data stored in ACNUC7421 zone)

EMBL: CP000094.PE429

CP000094.PE429       Location/Qualifiers
FT   CDS             complement(491021..491623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0431"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72175"
FT                   /db_xref="GOA:Q3KJ81"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ81"
FT                   /protein_id="ABA72175.1"
FT                   /translation="MNVFLKSLGALALLTLSSLANAFDLQQLSEQLAKPDVIHGQFIQE
FT                   KHLRALPQPLISKGSFVLAKNHGLLWLLKTPLQQDYRISAKGIARRDATGWQLLPNKSA
FT                   GAEQNRLFLAVLQGDSSGLQRDFELALSGDAQKWQLTLTPRSVLLKQVFNQINISGGTL
FT                   VNTIELLETQGDSTVLRMQDSTAGQPLSDAEQHDFAE"
     MNVFLKSLGA LALLTLSSLA NAFDLQQLSE QLAKPDVIHG QFIQEKHLRA LPQPLISKGS        60
     FVLAKNHGLL WLLKTPLQQD YRISAKGIAR RDATGWQLLP NKSAGAEQNR LFLAVLQGDS       120
     SGLQRDFELA LSGDAQKWQL TLTPRSVLLK QVFNQINISG GTLVNTIELL ETQGDSTVLR       180
     MQDSTAGQPL SDAEQHDFAE                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page