(data stored in ACNUC7421 zone)

EMBL: CP000094.PE43

CP000094.PE43        Location/Qualifiers
FT   CDS             complement(48030..48494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71787"
FT                   /db_xref="GOA:Q3KKB9"
FT                   /db_xref="InterPro:IPR014453"
FT                   /db_xref="InterPro:IPR036501"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB9"
FT                   /protein_id="ABA71787.1"
FT                   /translation="MKGLKTLAAALLLGGSAMAMAANDGQARVNELLSSDPQYRETWEG
FT                   VVKKEERLPEWVMNLSGAPDQQMNAVTEDGDQYLVGPLCESQDKCLNHRLIVAFSFDKK
FT                   HAYAMLVDVPEGLPADKSPTRHATYRFLGKPDQGMQDLLMETLKKDPNWY"
     MKGLKTLAAA LLLGGSAMAM AANDGQARVN ELLSSDPQYR ETWEGVVKKE ERLPEWVMNL        60
     SGAPDQQMNA VTEDGDQYLV GPLCESQDKC LNHRLIVAFS FDKKHAYAML VDVPEGLPAD       120
     KSPTRHATYR FLGKPDQGMQ DLLMETLKKD PNWY                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page