(data stored in ACNUC7421 zone)

EMBL: CP000094.PE430

CP000094.PE430       Location/Qualifiers
FT   CDS             complement(491620..492045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72176"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ80"
FT                   /protein_id="ABA72176.1"
FT                   /translation="MRSAGVLHADTEILVPFFDVDTMHVVWHGHYVKYLEVARCALLDK
FT                   IGHNYNQMVDSGYAWPVIDLQLRYVRGAVFGQRLNVRASLVEWENRLKIHYLITDAQTG
FT                   ERLTRASSVQVAVEVSSREMQLASPKVFTDAVERMLR"
     MRSAGVLHAD TEILVPFFDV DTMHVVWHGH YVKYLEVARC ALLDKIGHNY NQMVDSGYAW        60
     PVIDLQLRYV RGAVFGQRLN VRASLVEWEN RLKIHYLITD AQTGERLTRA SSVQVAVEVS       120
     SREMQLASPK VFTDAVERML R                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page