(data stored in ACNUC7421 zone)

EMBL: CP000094.PE436

CP000094.PE436       Location/Qualifiers
FT   CDS             complement(497452..497706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0438"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72182"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ74"
FT                   /protein_id="ABA72182.1"
FT                   /translation="MQTRDDIFNTLRDALVELFELDPARVSLESNLYQDLEIDSIDAVD
FT                   LIDHIKRQTGKKIAAEEFKSVRTVSDVVEAVYRLVQPAA"
     MQTRDDIFNT LRDALVELFE LDPARVSLES NLYQDLEIDS IDAVDLIDHI KRQTGKKIAA        60
     EEFKSVRTVS DVVEAVYRLV QPAA                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page