(data stored in ACNUC7421 zone)

EMBL: CP000094.PE439

CP000094.PE439       Location/Qualifiers
FT   CDS             complement(498742..499467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72185"
FT                   /db_xref="GOA:Q3KJ71"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ71"
FT                   /protein_id="ABA72185.1"
FT                   /translation="MSVINFNIAQWRAWAPGLDSVEAWQAWSRQPVVLESSDAAPDVSF
FT                   LPAMQRRRLSRLARMAFSVGWPLADGRENLPLVFVSRHGETPRTFEILSDLANDQPLSP
FT                   TQFSLSVHNAIIGLWSIMRGETSEMTALAAAGDGLEHGMLEAATLLNEGAPAVLLVITE
FT                   EQPPEAYSTWIDDVPFPYAVGLLLTPGTDWRLTLNSAPEARSKTQWPHALNLLRTLLDQ
FT                   QPHCQHAWKNRLWTWQRNP"
     MSVINFNIAQ WRAWAPGLDS VEAWQAWSRQ PVVLESSDAA PDVSFLPAMQ RRRLSRLARM        60
     AFSVGWPLAD GRENLPLVFV SRHGETPRTF EILSDLANDQ PLSPTQFSLS VHNAIIGLWS       120
     IMRGETSEMT ALAAAGDGLE HGMLEAATLL NEGAPAVLLV ITEEQPPEAY STWIDDVPFP       180
     YAVGLLLTPG TDWRLTLNSA PEARSKTQWP HALNLLRTLL DQQPHCQHAW KNRLWTWQRN       240
     P                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page