(data stored in ACNUC7421 zone)

EMBL: CP000094.PE442

CP000094.PE442       Location/Qualifiers
FT   CDS             complement(501131..502594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72188"
FT                   /db_xref="GOA:Q3KJ68"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ68"
FT                   /protein_id="ABA72188.1"
FT                   /translation="MKALDELTFDNRFARLGDAFSAHVLPEPIDNPRLVVASPAALALL
FT                   DLDPAMADTQEFAELFGGHKLWADAEPRAMVYSGHQFGGYTPQLGDGRGLLLGEVYNAA
FT                   GEHWDLHLKGAGQTPFSRMGDGRAVLRSSIREFLASEALHALNIPSSRAACVIGSDTPV
FT                   WREKQERAAMVLRLAPSHIRFGHFEYFYYTKRPEQQKLLGEHVLAMHYPECLEQPEPYL
FT                   AMFREIVERNAELIAKWQAYGFCHGVMNTDNMSILGITFDFGPFAFLDDFDANFICNHS
FT                   DDQGRYSFSNQVPVGQWNLSTLAQALTPLISVEALRETLGLYLPLFQAHYLDLMRRRLG
FT                   FTTAEDDDQMLLEQLLQLMQNSGVDYTLFFRRLGEESAEQAVARLRDDFVDIKGFDAWG
FT                   ERYVARVARDGATDQEQRRARMHAVNPLYILRNYLAQKAIDAAEQGDYSEVRRLHAVLS
FT                   NPFEEQPGMESYAERPPEWGKHLEISCSS"
     MKALDELTFD NRFARLGDAF SAHVLPEPID NPRLVVASPA ALALLDLDPA MADTQEFAEL        60
     FGGHKLWADA EPRAMVYSGH QFGGYTPQLG DGRGLLLGEV YNAAGEHWDL HLKGAGQTPF       120
     SRMGDGRAVL RSSIREFLAS EALHALNIPS SRAACVIGSD TPVWREKQER AAMVLRLAPS       180
     HIRFGHFEYF YYTKRPEQQK LLGEHVLAMH YPECLEQPEP YLAMFREIVE RNAELIAKWQ       240
     AYGFCHGVMN TDNMSILGIT FDFGPFAFLD DFDANFICNH SDDQGRYSFS NQVPVGQWNL       300
     STLAQALTPL ISVEALRETL GLYLPLFQAH YLDLMRRRLG FTTAEDDDQM LLEQLLQLMQ       360
     NSGVDYTLFF RRLGEESAEQ AVARLRDDFV DIKGFDAWGE RYVARVARDG ATDQEQRRAR       420
     MHAVNPLYIL RNYLAQKAID AAEQGDYSEV RRLHAVLSNP FEEQPGMESY AERPPEWGKH       480
     LEISCSS                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page