(data stored in ACNUC7421 zone)

EMBL: CP000094.PE445

CP000094.PE445       Location/Qualifiers
FT   CDS             complement(508115..509740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0447"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72191"
FT                   /db_xref="GOA:Q3KJ65"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ65"
FT                   /protein_id="ABA72191.1"
FT                   /translation="MSLRNMNIAPRAFTGFALIGGLMLILGVFALNQMSKIRGAAEDIS
FT                   SSSVPSIKNLDEFTQLTLRLRVLSYRLLVNREPDVQQKTMDLLDMRNQQIRKAQTDYEP
FT                   LIGSPEERAAYDQYVQLLGQYRQIEDRMKTLSRNNQVDELRNLLNTQLLDNSEAINTVL
FT                   NRLMQINGQQISETNQQAADQYSSAFNLVVTLLVIATGLTFLFAWLLTVSITKPIAKAL
FT                   DAAETIAEGNLTQPIQVDGTDEAGRLLAAMAKMQSKLRDTLQRISGSATQLASAAEELN
FT                   SVTDESARGLTQQNNEIEQAATAVNEMTSAVEEVARNAVSTSEASKNATTSAGDGRDLV
FT                   QETVSAIERMSADVQSTATLIGDLANESRDIGKVLDVIRGLADQTNLLALNAAIEAARA
FT                   GEAGRGFAVVADEVRALAHRTQQSTSEIERMIGSIQSGTEHAVDSMRNSTERAESTLNI
FT                   ARGAGLSLDTINTAIVEINERNLVIASAAEEQAQVAREVDRNLVNIRDLSVQSATGANQ
FT                   TSAASNELSRLALDLNNMVGRFSL"
     MSLRNMNIAP RAFTGFALIG GLMLILGVFA LNQMSKIRGA AEDISSSSVP SIKNLDEFTQ        60
     LTLRLRVLSY RLLVNREPDV QQKTMDLLDM RNQQIRKAQT DYEPLIGSPE ERAAYDQYVQ       120
     LLGQYRQIED RMKTLSRNNQ VDELRNLLNT QLLDNSEAIN TVLNRLMQIN GQQISETNQQ       180
     AADQYSSAFN LVVTLLVIAT GLTFLFAWLL TVSITKPIAK ALDAAETIAE GNLTQPIQVD       240
     GTDEAGRLLA AMAKMQSKLR DTLQRISGSA TQLASAAEEL NSVTDESARG LTQQNNEIEQ       300
     AATAVNEMTS AVEEVARNAV STSEASKNAT TSAGDGRDLV QETVSAIERM SADVQSTATL       360
     IGDLANESRD IGKVLDVIRG LADQTNLLAL NAAIEAARAG EAGRGFAVVA DEVRALAHRT       420
     QQSTSEIERM IGSIQSGTEH AVDSMRNSTE RAESTLNIAR GAGLSLDTIN TAIVEINERN       480
     LVIASAAEEQ AQVAREVDRN LVNIRDLSVQ SATGANQTSA ASNELSRLAL DLNNMVGRFS       540
     L                                                                       541
//

If you have problems or comments...

PBIL Back to PBIL home page