(data stored in ACNUC7421 zone)

EMBL: CP000094.PE446

CP000094.PE446       Location/Qualifiers
FT   CDS             510021..510251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0448"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72192"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ64"
FT                   /protein_id="ABA72192.1"
FT                   /translation="MLEASLSQLEQLVSDLVQQNQALSETNQTLSTELAQAKDENESLQ
FT                   LSLMEQEEKHGATAARIQALVDRVNAGPVSA"
     MLEASLSQLE QLVSDLVQQN QALSETNQTL STELAQAKDE NESLQLSLME QEEKHGATAA        60
     RIQALVDRVN AGPVSA                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page