(data stored in ACNUC7421 zone)

EMBL: CP000094.PE447

CP000094.PE447       Location/Qualifiers
FT   CDS             510248..510550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72193"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ63"
FT                   /protein_id="ABA72193.1"
FT                   /translation="MNHGTAGVKVISILGEDYSIKAPAGEEQTLLDAALMLKAALADTK
FT                   RKYPTLIGDRLLVLAAMNLCSQQIEMKKQHQQELERYQEQVSATVETIAKTINQG"
     MNHGTAGVKV ISILGEDYSI KAPAGEEQTL LDAALMLKAA LADTKRKYPT LIGDRLLVLA        60
     AMNLCSQQIE MKKQHQQELE RYQEQVSATV ETIAKTINQG                             100
//

If you have problems or comments...

PBIL Back to PBIL home page