(data stored in ACNUC7421 zone)

EMBL: CP000094.PE452

CP000094.PE452       Location/Qualifiers
FT   CDS             520721..522736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72198"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ58"
FT                   /protein_id="ABA72198.1"
FT                   /translation="MFAPANQPRFTLTVEGAQFDLKVLEFTGKEAISQPFRFDLELVSE
FT                   RPDLDLESLLHCQAFLSFDEEGSGIHGQIYRVGQGDSGKRLTRYHVSLVPRLAYLGHRI
FT                   NQRIFQHQSVPQIVTQILKDHAILRDAFAFRLGSDYPPREYCVQYAESDLAFIQRLCAE
FT                   VGIHFHFQHSPDGHLLVFGDDQTVFPRLTEPTLYLPGSGMAASAPAIKRFTVRVETRTS
FT                   VVTRRDYDFTKPRLALQSRAESEQRPVLEDYHFPGQFTERETGKQLAQRTLERHVADYR
FT                   QAEGRSDQSALVSGHFLQLTEHPRQDLNDLWLLTAIEHRGRQPQVLEESVTSDGDDFQG
FT                   YRNTFFATPWDVFFRPPLGPEKPRMLGYQPAVVTGPQDSEIHCDEYGRVKVQLAWDRDG
FT                   ELNEHSSCWLRVASGWAHDRYGSVLIPRVGMEVLVGFIDSDADKPLVMGCLPNAATPVP
FT                   LELPADKTRSIFRSQSSPGGGGYNELRIEDRKGAEEIYLRAQRNWTQHVLNDQQVQVDN
FT                   QRSVVVTGLAKHELKADEQHITHGQRQTEVKQDDHLTVTGDRHIRVSNQAINASAQFHV
FT                   SAGQQVVIDGGASATIQAGGQWINIGPGGIFSSVPIVVGGAPMAAISAAPTVPGLPEKL
FT                   AAAPAAILTAAQIMSLKGDAPFCEECERCKGGVCAA"
     MFAPANQPRF TLTVEGAQFD LKVLEFTGKE AISQPFRFDL ELVSERPDLD LESLLHCQAF        60
     LSFDEEGSGI HGQIYRVGQG DSGKRLTRYH VSLVPRLAYL GHRINQRIFQ HQSVPQIVTQ       120
     ILKDHAILRD AFAFRLGSDY PPREYCVQYA ESDLAFIQRL CAEVGIHFHF QHSPDGHLLV       180
     FGDDQTVFPR LTEPTLYLPG SGMAASAPAI KRFTVRVETR TSVVTRRDYD FTKPRLALQS       240
     RAESEQRPVL EDYHFPGQFT ERETGKQLAQ RTLERHVADY RQAEGRSDQS ALVSGHFLQL       300
     TEHPRQDLND LWLLTAIEHR GRQPQVLEES VTSDGDDFQG YRNTFFATPW DVFFRPPLGP       360
     EKPRMLGYQP AVVTGPQDSE IHCDEYGRVK VQLAWDRDGE LNEHSSCWLR VASGWAHDRY       420
     GSVLIPRVGM EVLVGFIDSD ADKPLVMGCL PNAATPVPLE LPADKTRSIF RSQSSPGGGG       480
     YNELRIEDRK GAEEIYLRAQ RNWTQHVLND QQVQVDNQRS VVVTGLAKHE LKADEQHITH       540
     GQRQTEVKQD DHLTVTGDRH IRVSNQAINA SAQFHVSAGQ QVVIDGGASA TIQAGGQWIN       600
     IGPGGIFSSV PIVVGGAPMA AISAAPTVPG LPEKLAAAPA AILTAAQIMS LKGDAPFCEE       660
     CERCKGGVCA A                                                            671
//

If you have problems or comments...

PBIL Back to PBIL home page