(data stored in ACNUC7421 zone)

EMBL: CP000094.PE455

CP000094.PE455       Location/Qualifiers
FT   CDS             complement(524384..524797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72201"
FT                   /db_xref="InterPro:IPR032032"
FT                   /db_xref="InterPro:IPR038314"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ55"
FT                   /protein_id="ABA72201.1"
FT                   /translation="MRRPIISLLCLLSSYQIVASEGRTEQARQNLKNYGLSHCILAPFK
FT                   EHSAMKKDIELSAGAYSFMGKGLHTIVQNEDTLEVTHDPYAETEKHMADAYLKTSSTSK
FT                   QAGKNIVFYSCLEIYNSPEFDAFIKSQDRYLQN"
     MRRPIISLLC LLSSYQIVAS EGRTEQARQN LKNYGLSHCI LAPFKEHSAM KKDIELSAGA        60
     YSFMGKGLHT IVQNEDTLEV THDPYAETEK HMADAYLKTS STSKQAGKNI VFYSCLEIYN       120
     SPEFDAFIKS QDRYLQN                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page