(data stored in ACNUC7421 zone)

EMBL: CP000094.PE456

CP000094.PE456       Location/Qualifiers
FT   CDS             525178..526017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0458"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72202"
FT                   /db_xref="GOA:Q3KJ54"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ54"
FT                   /protein_id="ABA72202.1"
FT                   /translation="MNYRHAFHAGNHADVFKHLTLTRLIALMSRKEQPFAYLDSHAGIG
FT                   LYDLQGDQANRTGEYLEGIARLWDQPDLPALTADYMNVLHEMNPDGQLRYYPGSPELAR
FT                   RLTRSQDRVLLNEKHPEDGVLLKDNMKGDRRVAVHLGEGWHVARALLPVAEKRAVMLID
FT                   PPFEKLDEMQRCAASLREAISRMRQTVAAIWYPVKDQRALRRFYQDLAGTGAPKLLRVE
FT                   LLVHPLDTPNSLNGSGLAIANPPWGLEEELRELLPWLSKKLGQTQGGWQMDWLIAES"
     MNYRHAFHAG NHADVFKHLT LTRLIALMSR KEQPFAYLDS HAGIGLYDLQ GDQANRTGEY        60
     LEGIARLWDQ PDLPALTADY MNVLHEMNPD GQLRYYPGSP ELARRLTRSQ DRVLLNEKHP       120
     EDGVLLKDNM KGDRRVAVHL GEGWHVARAL LPVAEKRAVM LIDPPFEKLD EMQRCAASLR       180
     EAISRMRQTV AAIWYPVKDQ RALRRFYQDL AGTGAPKLLR VELLVHPLDT PNSLNGSGLA       240
     IANPPWGLEE ELRELLPWLS KKLGQTQGGW QMDWLIAES                              279
//

If you have problems or comments...

PBIL Back to PBIL home page