(data stored in ACNUC7421 zone)

EMBL: CP000094.PE458

CP000094.PE458       Location/Qualifiers
FT   CDS             complement(526838..529534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0460"
FT                   /product="conserved GGDEF/EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72204"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ52"
FT                   /protein_id="ABA72204.1"
FT                   /translation="MKSQPDAASRMVAEVVTQLPVPSRLGMLRFERLNEASWAMLFLDP
FT                   NCERQFGQPAVELCALVGSPYASLMEPEARYQLHDAIQQQLGQSPHYLVRYTLHTAAGA
FT                   LSILELGEAYKQHNRHLLRGYLLAVDNVFDETPSLPSVDLETQNSRLQIALELNQRAQQ
FT                   EQLQHLERVRAQQDLILLLARQRYSSQNSLQEAAELITRCACDIYEIDCASLWNLEGQK
FT                   LVPISAYHRATQEYILPDVIDVSGFPDYMDALHGSRAIDAHNAMRDPRTREMAEALRPR
FT                   DVNAMLDASIRVDGQVVGVLCLEQTGVTRAWQSDEIAFAGELADQFAQVINNHNRRTAT
FT                   SALHLFQRAVEQSANAFLLVNCDGVVEYVNPSFTAITQYTTEEVHGQRLSELPALENLS
FT                   ELLFDAPSALAKSNSWQGEFKSRRKNLEPYWGQLSISKVYGDNRELTHYIGIYEDITQT
FT                   KLAQQRIERLAYTDNLTNLGNRPAFIRNLDERFARDSDTPISLLLVDIDNFKRINDSLG
FT                   HQTGDKLLISLARRLRNSLSPSGSLARFASNEFAVLLDDTDLATGQQIANQLLATLDKP
FT                   MFVDNQLISVTGSVGLACAPLHGRDPQTLMRNAGLALHKAKANGKHQVQVFTEALNAEA
FT                   SYKLFVENNLRRALTQNELDVFYQPKLCLRSGRLLGMEALLRWNHPERGMIRPDQFISV
FT                   AEETGLIIPIGKWIARQACRMSKALTAAGMGNLQVAINLSPKQFSDPDLVASIANILKE
FT                   EALPANLLELELTEGLLLEATEDTHLQLDQLKRLGLTLAMDDFGTGYSSLSYLKKFPID
FT                   IIKIDRSFIHEIPDNQDDMEITSAVIAMAHNLKLKVVAEGIETAEQLAFLRRHRCDVGQ
FT                   GYLFDRPIPGGELIQALKRYPRGPLSL"
     MKSQPDAASR MVAEVVTQLP VPSRLGMLRF ERLNEASWAM LFLDPNCERQ FGQPAVELCA        60
     LVGSPYASLM EPEARYQLHD AIQQQLGQSP HYLVRYTLHT AAGALSILEL GEAYKQHNRH       120
     LLRGYLLAVD NVFDETPSLP SVDLETQNSR LQIALELNQR AQQEQLQHLE RVRAQQDLIL       180
     LLARQRYSSQ NSLQEAAELI TRCACDIYEI DCASLWNLEG QKLVPISAYH RATQEYILPD       240
     VIDVSGFPDY MDALHGSRAI DAHNAMRDPR TREMAEALRP RDVNAMLDAS IRVDGQVVGV       300
     LCLEQTGVTR AWQSDEIAFA GELADQFAQV INNHNRRTAT SALHLFQRAV EQSANAFLLV       360
     NCDGVVEYVN PSFTAITQYT TEEVHGQRLS ELPALENLSE LLFDAPSALA KSNSWQGEFK       420
     SRRKNLEPYW GQLSISKVYG DNRELTHYIG IYEDITQTKL AQQRIERLAY TDNLTNLGNR       480
     PAFIRNLDER FARDSDTPIS LLLVDIDNFK RINDSLGHQT GDKLLISLAR RLRNSLSPSG       540
     SLARFASNEF AVLLDDTDLA TGQQIANQLL ATLDKPMFVD NQLISVTGSV GLACAPLHGR       600
     DPQTLMRNAG LALHKAKANG KHQVQVFTEA LNAEASYKLF VENNLRRALT QNELDVFYQP       660
     KLCLRSGRLL GMEALLRWNH PERGMIRPDQ FISVAEETGL IIPIGKWIAR QACRMSKALT       720
     AAGMGNLQVA INLSPKQFSD PDLVASIANI LKEEALPANL LELELTEGLL LEATEDTHLQ       780
     LDQLKRLGLT LAMDDFGTGY SSLSYLKKFP IDIIKIDRSF IHEIPDNQDD MEITSAVIAM       840
     AHNLKLKVVA EGIETAEQLA FLRRHRCDVG QGYLFDRPIP GGELIQALKR YPRGPLSL         898
//

If you have problems or comments...

PBIL Back to PBIL home page