(data stored in ACNUC7421 zone)

EMBL: CP000094.PE46

CP000094.PE46        Location/Qualifiers
FT   CDS             49441..50787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0046"
FT                   /product="alginate biosynthesis transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71790"
FT                   /db_xref="GOA:Q3KKB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB6"
FT                   /protein_id="ABA71790.1"
FT                   /translation="MESATEHQGRILLVDDESAILRTFRYCLEDEGYTVATANSAAQAD
FT                   ALLQRQVFDLCFLDLRLGEDNGLDVLAQMRIQAPWMRVVIVTAHSAVDTAVDAIQAGAA
FT                   DYLVKPCSPDQLRLATAKQLEVRQLSARLEALEGEIRKPKDGLDSHSPAMKVVLETARQ
FT                   VAGTDANILILGESGTGKGELARAIHGWSKREKKSCVTINCPSLTAELMESELFGHSRG
FT                   AFTGASESTLGRVNQADGGTLFLDEIGDFPLTLQPKLLRFIQDKEYERVGDPVTRRADV
FT                   RILAATNLNLEDMVRDGRFREDLLYRLNVITLHLPPLRERAEDILTLADRFLARFVKEY
FT                   ARPARGFSDEAREALLGYRWPGNIRELRNVVERASIICPQERVEISHLGMAEQPANNAP
FT                   RVGAALSLDELEKAHIGAVLATAGTLDQAAKTLGIDASTLYRKRKQYNL"
     MESATEHQGR ILLVDDESAI LRTFRYCLED EGYTVATANS AAQADALLQR QVFDLCFLDL        60
     RLGEDNGLDV LAQMRIQAPW MRVVIVTAHS AVDTAVDAIQ AGAADYLVKP CSPDQLRLAT       120
     AKQLEVRQLS ARLEALEGEI RKPKDGLDSH SPAMKVVLET ARQVAGTDAN ILILGESGTG       180
     KGELARAIHG WSKREKKSCV TINCPSLTAE LMESELFGHS RGAFTGASES TLGRVNQADG       240
     GTLFLDEIGD FPLTLQPKLL RFIQDKEYER VGDPVTRRAD VRILAATNLN LEDMVRDGRF       300
     REDLLYRLNV ITLHLPPLRE RAEDILTLAD RFLARFVKEY ARPARGFSDE AREALLGYRW       360
     PGNIRELRNV VERASIICPQ ERVEISHLGM AEQPANNAPR VGAALSLDEL EKAHIGAVLA       420
     TAGTLDQAAK TLGIDASTLY RKRKQYNL                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page