(data stored in ACNUC7421 zone)

EMBL: CP000094.PE467

CP000094.PE467       Location/Qualifiers
FT   CDS             543464..544198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0469"
FT                   /product="putative lipopolysaccharide core biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72213"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ43"
FT                   /protein_id="ABA72213.1"
FT                   /translation="MAGWNLEPEYSDLAQHFGSLEAVFALQGERLTRDPLSEVIRVQLN
FT                   GVNYYVKRYVGAGKGLRRYLGKPRVKMEWQNLKRFAKWGIPTAEVVAWGLERNGMAYDR
FT                   GAMITRELPRTEDLSALAERNDPKLKDRAWVDGVSRQLAGYTRVMHDHRFTHNDLKWRN
FT                   LLIDDQAQLFLIDCPNGDFWRGFWLKYRITKDLACLDKVAKYHLSNTQRLRFYLQYRQR
FT                   DRLNAADKQRIRHVVRFFEGRE"
     MAGWNLEPEY SDLAQHFGSL EAVFALQGER LTRDPLSEVI RVQLNGVNYY VKRYVGAGKG        60
     LRRYLGKPRV KMEWQNLKRF AKWGIPTAEV VAWGLERNGM AYDRGAMITR ELPRTEDLSA       120
     LAERNDPKLK DRAWVDGVSR QLAGYTRVMH DHRFTHNDLK WRNLLIDDQA QLFLIDCPNG       180
     DFWRGFWLKY RITKDLACLD KVAKYHLSNT QRLRFYLQYR QRDRLNAADK QRIRHVVRFF       240
     EGRE                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page