(data stored in ACNUC7421 zone)

EMBL: CP000094.PE47

CP000094.PE47        Location/Qualifiers
FT   CDS             50798..52588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0047"
FT                   /product="putative two-component system, sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71791"
FT                   /db_xref="GOA:Q3KKB5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR031909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038320"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB5"
FT                   /protein_id="ABA71791.1"
FT                   /translation="MKLAMKLRTRLFLSISALITVALLGLMLGLVSVMQMAGTQEALIR
FT                   NNFVTLDLGLKLRQTLGDQLIMMLAEKPDPVAFEASKQHYFQLLDEGIAQEQKDDDRQY
FT                   GFSQAKADYLSFLQAFDISRDPAAALSGGGDLRERFNTLRNGLITEHKHALNNINSVQH
FT                   AARDRALLIAGLLGLVGLAVLIIGFVTAQGIARRFGAPIEALAKAADNIGQGNFEVTLP
FT                   VSSAMEINLLTRRFGLMAEALREHQATNVDELLAGQQRLQAVLDSIDDGLLMIDRQGRL
FT                   EHLNPVAQRQLGWDSDRFGEGLGTALQRPELDAQLQLVLRGGTLERAPEDLSIEVDGES
FT                   RLLTYSLTPVSHTQGHILGAVMVLHDVTEQRAFERVRSEFVLRASHELRTPVTGMHMAF
FT                   GLFRERAKFPEESRESDLLDTVNEEMQRLMQLINDLLNFSRYQSGLQKLTLAPCSIEEL
FT                   LERARLRFADSAAQKGVALNVEAQGSLPRLQADQAQLDRVLDNLIDNALRHTARDGLIR
FT                   LQARRHGERVIISVEDNGEGIAYGQQGRIFEPFVQVGRKKGGAGLGLALCKEIVQLHGG
FT                   RMGVYSRPGQGTQFYMALAV"
     MKLAMKLRTR LFLSISALIT VALLGLMLGL VSVMQMAGTQ EALIRNNFVT LDLGLKLRQT        60
     LGDQLIMMLA EKPDPVAFEA SKQHYFQLLD EGIAQEQKDD DRQYGFSQAK ADYLSFLQAF       120
     DISRDPAAAL SGGGDLRERF NTLRNGLITE HKHALNNINS VQHAARDRAL LIAGLLGLVG       180
     LAVLIIGFVT AQGIARRFGA PIEALAKAAD NIGQGNFEVT LPVSSAMEIN LLTRRFGLMA       240
     EALREHQATN VDELLAGQQR LQAVLDSIDD GLLMIDRQGR LEHLNPVAQR QLGWDSDRFG       300
     EGLGTALQRP ELDAQLQLVL RGGTLERAPE DLSIEVDGES RLLTYSLTPV SHTQGHILGA       360
     VMVLHDVTEQ RAFERVRSEF VLRASHELRT PVTGMHMAFG LFRERAKFPE ESRESDLLDT       420
     VNEEMQRLMQ LINDLLNFSR YQSGLQKLTL APCSIEELLE RARLRFADSA AQKGVALNVE       480
     AQGSLPRLQA DQAQLDRVLD NLIDNALRHT ARDGLIRLQA RRHGERVIIS VEDNGEGIAY       540
     GQQGRIFEPF VQVGRKKGGA GLGLALCKEI VQLHGGRMGV YSRPGQGTQF YMALAV           596
//

If you have problems or comments...

PBIL Back to PBIL home page