(data stored in ACNUC7421 zone)

EMBL: CP000094.PE470

CP000094.PE470       Location/Qualifiers
FT   CDS             546522..546893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0472"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72216"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ40"
FT                   /protein_id="ABA72216.1"
FT                   /translation="MLVCPDVPGGQILTIKNAIAIGAFSLALSGCGTAVTVLQGDEAAT
FT                   RGLRKQKTYCQSIPRIYSGLAHDFCLLHAPPDPTGILVPVVLLDLTLSGVFDTAFLPYT
FT                   IYRQAVDGNISVYWRPSRG"
     MLVCPDVPGG QILTIKNAIA IGAFSLALSG CGTAVTVLQG DEAATRGLRK QKTYCQSIPR        60
     IYSGLAHDFC LLHAPPDPTG ILVPVVLLDL TLSGVFDTAF LPYTIYRQAV DGNISVYWRP       120
     SRG                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page