(data stored in ACNUC7421 zone)

EMBL: CP000094.PE478

CP000094.PE478       Location/Qualifiers
FT   CDS             complement(555573..557435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0480"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72224"
FT                   /db_xref="GOA:Q3KJ32"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ32"
FT                   /protein_id="ABA72224.1"
FT                   /translation="MQFSGFSSTSSRIFDFISLWILPVGYFLLLCALFFLPGRSLHHKL
FT                   FYGLFSIPTLIALCLRPRELKEMLREPVFIALLLFAGWALLSLCWGPQDEPIGGMFKPP
FT                   LHTLMLFAGCFLLVRYRSDILTPLLFAAALVALIATIAFLIPFMLHFEPGARLIGGGAF
FT                   DNPLLSSHLFGFFCAYWLSLSMTCKNRRLYWLSIPAMLIMFMAVIGTGSRTPLVALTMA
FT                   ALWLSLICWNRRSLVLLGTLAIGGATVVVLFSKMIIERGDSYRFEIWQQALEKIAEHPW
FT                   IGHGYNAVLAIDPGVGYNFQEPHSFALGVLYYVGILGMLPWLFFQAWGLLSSWRQRVQP
FT                   LLIIASTWLVFGIGAGLTEGGGIISRPKEHWFLLWIPLALIAALSINQRARRLLAMPVQ
FT                   KLSATALQQLSSDAQVIEEDGLGPKVLRLSDGSFLKLFRHRRWYTSGSFNPYSERFAVN
FT                   SEQLRRMGIPTPQVLNLYRLDDGSSAVHYTPLPGHTLRQVLQGITAPAVRHALVERFGK
FT                   FMASLHEQGVYFRSLHLGNVLVLEDGEFGLIDLADLRIYPSPLSLSLRQRNLRHMQRYT
FT                   VDRRWLFEDHLEALLQGYAVTASKSAVDNLHRQVLAGNTPARVH"
     MQFSGFSSTS SRIFDFISLW ILPVGYFLLL CALFFLPGRS LHHKLFYGLF SIPTLIALCL        60
     RPRELKEMLR EPVFIALLLF AGWALLSLCW GPQDEPIGGM FKPPLHTLML FAGCFLLVRY       120
     RSDILTPLLF AAALVALIAT IAFLIPFMLH FEPGARLIGG GAFDNPLLSS HLFGFFCAYW       180
     LSLSMTCKNR RLYWLSIPAM LIMFMAVIGT GSRTPLVALT MAALWLSLIC WNRRSLVLLG       240
     TLAIGGATVV VLFSKMIIER GDSYRFEIWQ QALEKIAEHP WIGHGYNAVL AIDPGVGYNF       300
     QEPHSFALGV LYYVGILGML PWLFFQAWGL LSSWRQRVQP LLIIASTWLV FGIGAGLTEG       360
     GGIISRPKEH WFLLWIPLAL IAALSINQRA RRLLAMPVQK LSATALQQLS SDAQVIEEDG       420
     LGPKVLRLSD GSFLKLFRHR RWYTSGSFNP YSERFAVNSE QLRRMGIPTP QVLNLYRLDD       480
     GSSAVHYTPL PGHTLRQVLQ GITAPAVRHA LVERFGKFMA SLHEQGVYFR SLHLGNVLVL       540
     EDGEFGLIDL ADLRIYPSPL SLSLRQRNLR HMQRYTVDRR WLFEDHLEAL LQGYAVTASK       600
     SAVDNLHRQV LAGNTPARVH                                                   620
//

If you have problems or comments...

PBIL Back to PBIL home page