(data stored in ACNUC7421 zone)

EMBL: CP000094.PE479

CP000094.PE479       Location/Qualifiers
FT   CDS             557590..559392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0481"
FT                   /product="lipid A export ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72225"
FT                   /db_xref="GOA:Q3KJ31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ31"
FT                   /protein_id="ABA72225.1"
FT                   /translation="MTDSSPAASPSSLKIYFRLLGYVRPYISLFLISIVGFLIFASTQP
FT                   MLGYILKYFVDGLSNPEAVLFPTVPYLRDLQLLQAVPLLIILIAAWQGLGSYLGNYFLA
FT                   KVSLGLVHDLRVQLFNNLLVLPNRYFDKHNSGHLISRITFNVTMVTGAATDAIKVVIRE
FT                   GMTVIFLFASLLFMNWKLTLVMVAILPLIAVMVRTASKKFRKQSKKIQLAMGDVTHVAS
FT                   ETIQGYRVVRSFGGEAYEEKRFLDASQGNTDKQLRMTRTGAIYTPLLQLVIYSAMAILM
FT                   FLVLYLRGDASAGDMVAYITLAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEPEV
FT                   DTGTVERDSVSGRLDVRNLSFTYPGTERQVLDDISFSVEPGQMVALVGRSGSGKSTLAN
FT                   LIPRFYHHDKGEILIDGVEVEQYKLLNLRRHIAQVTQHVTLFSDTVANNIAYGDLAGAP
FT                   REDIEKAARDAYAMDFIAQLPEGLDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILD
FT                   EATSALDTESERHIQAALDQVMKGRTTLVIAHRLSTIEKADLILVMDQGRIVERGTHDD
FT                   LLAQNGYYARLNAMGLDAPAEDIA"
     MTDSSPAASP SSLKIYFRLL GYVRPYISLF LISIVGFLIF ASTQPMLGYI LKYFVDGLSN        60
     PEAVLFPTVP YLRDLQLLQA VPLLIILIAA WQGLGSYLGN YFLAKVSLGL VHDLRVQLFN       120
     NLLVLPNRYF DKHNSGHLIS RITFNVTMVT GAATDAIKVV IREGMTVIFL FASLLFMNWK       180
     LTLVMVAILP LIAVMVRTAS KKFRKQSKKI QLAMGDVTHV ASETIQGYRV VRSFGGEAYE       240
     EKRFLDASQG NTDKQLRMTR TGAIYTPLLQ LVIYSAMAIL MFLVLYLRGD ASAGDMVAYI       300
     TLAGLLPKPI RQLSEVSSTI QKGVAGAESI FEQLDVEPEV DTGTVERDSV SGRLDVRNLS       360
     FTYPGTERQV LDDISFSVEP GQMVALVGRS GSGKSTLANL IPRFYHHDKG EILIDGVEVE       420
     QYKLLNLRRH IAQVTQHVTL FSDTVANNIA YGDLAGAPRE DIEKAARDAY AMDFIAQLPE       480
     GLDTQVGENG VLLSGGQRQR LAIARALLKN APLLILDEAT SALDTESERH IQAALDQVMK       540
     GRTTLVIAHR LSTIEKADLI LVMDQGRIVE RGTHDDLLAQ NGYYARLNAM GLDAPAEDIA       600
//

If you have problems or comments...

PBIL Back to PBIL home page