(data stored in ACNUC7421 zone)

EMBL: CP000094.PE48

CP000094.PE48        Location/Qualifiers
FT   CDS             complement(52585..54201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71792"
FT                   /db_xref="GOA:Q3KKB4"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB4"
FT                   /protein_id="ABA71792.1"
FT                   /translation="MMVATRETLRSWFYRPWFLAMIAAVLSASLLITGGLFVAMRQVEQ
FT                   SESQEMNAQGERFLARLEQLFGQLRESLDDLEAQPLRSCDDEMIATLQQVTFNYRFVYE
FT                   AAYMDATRICSNRPRQEGLSVIRPPDIKGPTYSYWLNTTTEPDENRAALMLGRGNFRVA
FT                   TSRGHLTDMVDLSPGSSLLVVLDHGTRAIPVLGVPQAWPPTEPWPPKTPNALQVTQSHL
FT                   IYRMPTDNPEYQLVLISPRTGMHIPELWWWMVPFCLVLGAFVGVLVFWIVRQRQSLDAE
FT                   LHGAIRRGELQVLYQPIFDLDSRNCVGAEALLRWRRPDGTLTSPDLFIPMAENTGQIRQ
FT                   MTDFVLQRLLEQLGQLLRANPQLYISVNLAACDVMVPRIGQVMARLLTLHRVAARQIAF
FT                   EVTERGLIDVVVARENLQALRDVGHQVLIDDFGTGYCSLAYLQTLPVDCLKIDKAFIDA
FT                   LGHDAASSGVAPHIIHMAQALDLKVIAEGIEFESQAALLSSEGVKFGQGWLFAHALSAV
FT                   QFIELITRGRRLAGRRLDDEA"
     MMVATRETLR SWFYRPWFLA MIAAVLSASL LITGGLFVAM RQVEQSESQE MNAQGERFLA        60
     RLEQLFGQLR ESLDDLEAQP LRSCDDEMIA TLQQVTFNYR FVYEAAYMDA TRICSNRPRQ       120
     EGLSVIRPPD IKGPTYSYWL NTTTEPDENR AALMLGRGNF RVATSRGHLT DMVDLSPGSS       180
     LLVVLDHGTR AIPVLGVPQA WPPTEPWPPK TPNALQVTQS HLIYRMPTDN PEYQLVLISP       240
     RTGMHIPELW WWMVPFCLVL GAFVGVLVFW IVRQRQSLDA ELHGAIRRGE LQVLYQPIFD       300
     LDSRNCVGAE ALLRWRRPDG TLTSPDLFIP MAENTGQIRQ MTDFVLQRLL EQLGQLLRAN       360
     PQLYISVNLA ACDVMVPRIG QVMARLLTLH RVAARQIAFE VTERGLIDVV VARENLQALR       420
     DVGHQVLIDD FGTGYCSLAY LQTLPVDCLK IDKAFIDALG HDAASSGVAP HIIHMAQALD       480
     LKVIAEGIEF ESQAALLSSE GVKFGQGWLF AHALSAVQFI ELITRGRRLA GRRLDDEA         538
//

If you have problems or comments...

PBIL Back to PBIL home page