(data stored in ACNUC7421 zone)

EMBL: CP000094.PE482

CP000094.PE482       Location/Qualifiers
FT   CDS             560968..562392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0484"
FT                   /product="D-alpha,beta-D-heptose 7-phosphate 1-kinase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72228"
FT                   /db_xref="GOA:Q3KJ28"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KJ28"
FT                   /protein_id="ABA72228.1"
FT                   /translation="MKLSMPRFDQAPVLVVGDVMLDRYWHGGTSRISPEAPVPVVKVEQ
FT                   IEDRPGGAANVALNIAALGAPASLVGVTGDDEAADSLSNSLKGAGVRALFQRIAHQPTI
FT                   VKLRVMSRHQQLLRIDFEEPFATDALALGAQVDDLLEGIKVLVLSDYGKGALKNHQALI
FT                   QAARAKGIPVLADPKGKDFSIYRGASLITPNLSEFEAIVGGCADEHELVTKGATLMHDL
FT                   DLGALLVTRGEHGMTLLRPDHPALHLPARAREVFDVTGAGDTVISTLAAAIAAGEELPH
FT                   AVALANLAAGIVVGKLGTAAISAPELRRAIQREEGSERGVLGLEQLLLAVADARAHNEK
FT                   IVFTNGCFDILHAGHVTYLEQARAQGDRLIVAINDDASVSRLKGPGRPINSVDRRMAVL
FT                   AGLGAVDWVISFAEGTPENLLREVKPDVLVKGGDYGIDQVVGADIVKAYGGAVKVLGLV
FT                   ENSSTTAIVEKIRKSE"
     MKLSMPRFDQ APVLVVGDVM LDRYWHGGTS RISPEAPVPV VKVEQIEDRP GGAANVALNI        60
     AALGAPASLV GVTGDDEAAD SLSNSLKGAG VRALFQRIAH QPTIVKLRVM SRHQQLLRID       120
     FEEPFATDAL ALGAQVDDLL EGIKVLVLSD YGKGALKNHQ ALIQAARAKG IPVLADPKGK       180
     DFSIYRGASL ITPNLSEFEA IVGGCADEHE LVTKGATLMH DLDLGALLVT RGEHGMTLLR       240
     PDHPALHLPA RAREVFDVTG AGDTVISTLA AAIAAGEELP HAVALANLAA GIVVGKLGTA       300
     AISAPELRRA IQREEGSERG VLGLEQLLLA VADARAHNEK IVFTNGCFDI LHAGHVTYLE       360
     QARAQGDRLI VAINDDASVS RLKGPGRPIN SVDRRMAVLA GLGAVDWVIS FAEGTPENLL       420
     REVKPDVLVK GGDYGIDQVV GADIVKAYGG AVKVLGLVEN SSTTAIVEKI RKSE             474
//

If you have problems or comments...

PBIL Back to PBIL home page