(data stored in ACNUC7421 zone)

EMBL: CP000094.PE486

CP000094.PE486       Location/Qualifiers
FT   CDS             complement(565573..565905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0488"
FT                   /product="quaternary ammonium compound-resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72232"
FT                   /db_xref="GOA:Q3KJ24"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ24"
FT                   /protein_id="ABA72232.1"
FT                   /translation="MNAYVYLAIAICAEVIATVSMKAVKGFSTPLPLLLVVVGYGIAFW
FT                   MLTLVVRSVPVGVAYAVWAGMGIVMVSVAALFIYGQKLDIPAMLGMALIVLGVVVIQLF
FT                   SKTAGH"
     MNAYVYLAIA ICAEVIATVS MKAVKGFSTP LPLLLVVVGY GIAFWMLTLV VRSVPVGVAY        60
     AVWAGMGIVM VSVAALFIYG QKLDIPAMLG MALIVLGVVV IQLFSKTAGH                  110
//

If you have problems or comments...

PBIL Back to PBIL home page