(data stored in ACNUC7421 zone)

EMBL: CP000094.PE487

CP000094.PE487       Location/Qualifiers
FT   CDS             566008..566910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0489"
FT                   /product="putative LysR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72233"
FT                   /db_xref="GOA:Q3KJ23"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ23"
FT                   /protein_id="ABA72233.1"
FT                   /translation="MSMQWNLEQLRVFVEVAEQRSFSAVARQQRKAQSAISSAIAMLED
FT                   DLGVSLFERSSGRQPSLTEAGEALLEEAREVLRQCERLNGRAVAMMRGQEAQLRVAQDE
FT                   AMPYQALVESFGALAEQFPSLEVQLTSAAQGEVSRKLVERRADLGLLFYHDEIPEALER
FT                   RVLGSVEMVTVCGVNHPLASQAYVTCQQLAQHRQLLMSTQTSIYPGNEPASPQVWRADS
FT                   FYVMAEWLVRDLGWAWLPRHVVQYSAYQGLMVELDSEWTPPALVVELVWRRDEPLGPAA
FT                   RWLAERFAIHLRAIGGKSR"
     MSMQWNLEQL RVFVEVAEQR SFSAVARQQR KAQSAISSAI AMLEDDLGVS LFERSSGRQP        60
     SLTEAGEALL EEAREVLRQC ERLNGRAVAM MRGQEAQLRV AQDEAMPYQA LVESFGALAE       120
     QFPSLEVQLT SAAQGEVSRK LVERRADLGL LFYHDEIPEA LERRVLGSVE MVTVCGVNHP       180
     LASQAYVTCQ QLAQHRQLLM STQTSIYPGN EPASPQVWRA DSFYVMAEWL VRDLGWAWLP       240
     RHVVQYSAYQ GLMVELDSEW TPPALVVELV WRRDEPLGPA ARWLAERFAI HLRAIGGKSR       300
//

If you have problems or comments...

PBIL Back to PBIL home page