(data stored in ACNUC7421 zone)

EMBL: CP000094.PE493

CP000094.PE493       Location/Qualifiers
FT   CDS             574356..574973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72239"
FT                   /db_xref="GOA:Q3KJ17"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ17"
FT                   /protein_id="ABA72239.1"
FT                   /translation="MTDFAKAIPTAVDIVRREQCYKGFYKLDRLHLRHELFAGGMSREI
FT                   NREVFVRHDAVCMLPYDPQRDEVVLIEQFRVGALGKTDNPWLVELVAGLIDKDEQPEEV
FT                   AHREAQEEAGLDIKALWPMTKYFPSPGGSNEFVHLYLGRCSTEGAGGLHGLEEEAEDIR
FT                   VTVWAFEDALQAVRDGRIANAASIIALQWLALNRAEVRGLWS"
     MTDFAKAIPT AVDIVRREQC YKGFYKLDRL HLRHELFAGG MSREINREVF VRHDAVCMLP        60
     YDPQRDEVVL IEQFRVGALG KTDNPWLVEL VAGLIDKDEQ PEEVAHREAQ EEAGLDIKAL       120
     WPMTKYFPSP GGSNEFVHLY LGRCSTEGAG GLHGLEEEAE DIRVTVWAFE DALQAVRDGR       180
     IANAASIIAL QWLALNRAEV RGLWS                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page