(data stored in ACNUC7421 zone)

EMBL: CP000094.PE494

CP000094.PE494       Location/Qualifiers
FT   CDS             574964..575416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0496"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72240"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ16"
FT                   /protein_id="ABA72240.1"
FT                   /translation="MVVNKLRDRYRVDLVGLQAACEANYARLMRLLPDMRSDPEARRIA
FT                   VTQGDQMLGVLTLEVLQACPYTTTLQVRQEHSLPWLPVPQLEVQVYHDARMAEVISAEH
FT                   ARRFRGVYPYPNAAMHQPDEKAQLNLFLGEWLSHCLACGHEYAAVR"
     MVVNKLRDRY RVDLVGLQAA CEANYARLMR LLPDMRSDPE ARRIAVTQGD QMLGVLTLEV        60
     LQACPYTTTL QVRQEHSLPW LPVPQLEVQV YHDARMAEVI SAEHARRFRG VYPYPNAAMH       120
     QPDEKAQLNL FLGEWLSHCL ACGHEYAAVR                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page