(data stored in ACNUC7421 zone)

EMBL: CP000094.PE496

CP000094.PE496       Location/Qualifiers
FT   CDS             576434..577042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72242"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ14"
FT                   /protein_id="ABA72242.1"
FT                   /translation="MSGSILYIHGFNSAPASKKACQLVEVMERLGLSDQLRVPALHHHP
FT                   REAIGQLEQAIAELGRPLLVGSSLGGYYATHLAERHGLKALLVNPAVSPHRMFDGYLGT
FT                   QKNLYTDETWELTHDHVTALAELEVPAPQDLQRYQVWLQTGDETLDYRLAQQYYRACAL
FT                   RIQAGGDHSFQGFVTQLPALLSFAGIGADTYQAIDFTAL"
     MSGSILYIHG FNSAPASKKA CQLVEVMERL GLSDQLRVPA LHHHPREAIG QLEQAIAELG        60
     RPLLVGSSLG GYYATHLAER HGLKALLVNP AVSPHRMFDG YLGTQKNLYT DETWELTHDH       120
     VTALAELEVP APQDLQRYQV WLQTGDETLD YRLAQQYYRA CALRIQAGGD HSFQGFVTQL       180
     PALLSFAGIG ADTYQAIDFT AL                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page