(data stored in ACNUC7421 zone)

EMBL: CP000094.PE498

CP000094.PE498       Location/Qualifiers
FT   CDS             578992..579981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0500"
FT                   /product="putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72244"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ12"
FT                   /protein_id="ABA72244.1"
FT                   /translation="MRFGRALAGALLLGSMTVSAEPAQELRVLAEHPVEGMRGGNLSGL
FT                   ALCGNDLWTVSDRDDDQIYRLDTRDPVWQATAVRIDPPPVPDSGLPWGIKSRTWAASFV
FT                   RGGDLDFEGITCDSAGNRYIVSEGHAAVLQVPPQGPSSWLKISPMMVREARASGMLLQF
FT                   NAIFEGLAINPAGDQMWLAAERQSRGLLLIKRQQTVWDCDGRCVLLSEGGMEMQPPQFP
FT                   KARPVNRDFSDVSLFDGKLFTLERNAYQICRRDAQTAKVELCWSYAAELLQANRRYSQN
FT                   FGLEEALVVDAQGAWIGVDNNFGPRADGEVRPIIWRFAAPEGGWSAKP"
     MRFGRALAGA LLLGSMTVSA EPAQELRVLA EHPVEGMRGG NLSGLALCGN DLWTVSDRDD        60
     DQIYRLDTRD PVWQATAVRI DPPPVPDSGL PWGIKSRTWA ASFVRGGDLD FEGITCDSAG       120
     NRYIVSEGHA AVLQVPPQGP SSWLKISPMM VREARASGML LQFNAIFEGL AINPAGDQMW       180
     LAAERQSRGL LLIKRQQTVW DCDGRCVLLS EGGMEMQPPQ FPKARPVNRD FSDVSLFDGK       240
     LFTLERNAYQ ICRRDAQTAK VELCWSYAAE LLQANRRYSQ NFGLEEALVV DAQGAWIGVD       300
     NNFGPRADGE VRPIIWRFAA PEGGWSAKP                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page