(data stored in ACNUC7421 zone)

EMBL: CP000094.PE501

CP000094.PE501       Location/Qualifiers
FT   CDS             581842..584106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0503"
FT                   /product="topoisomerase IV subunit A"
FT                   /EC_number="5.99.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72247"
FT                   /db_xref="GOA:Q3KJ09"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ09"
FT                   /protein_id="ABA72247.1"
FT                   /translation="MSDNLADSLDGVERRSLADFTENAYLNYSMYVIMDRALPHIGDGL
FT                   KPVQRRIVYAMSELGLDADSKHKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRY
FT                   TLVDGQGNWGAPDDPKSFAAMRYTEARLSRYSEVLLSELGQGTADWGPNFDGTLQEPLV
FT                   LPARLPNILLNGTTGIAVGMATDVPPHNLREVATACVRLLDEPKATVEQLCEHIQGPDY
FT                   PTEAEIITPRADLLKMYETGKGSVRMRAVYHVEDGDIIVTALPHQVSGAKVLEQIAALM
FT                   QAKPSKAPQIADLRDESDHENPCRIVIIPVNSRVDHEALMQHLFASTELESTYRVNVNI
FT                   IGLDGKPQLKNLRALLVEWLEFRVLTVRRRLQFRLDKVERRLHLLDGLLIAYLNLDEVI
FT                   HIIRTEEHPKAKLIERFALSEIQADYILDTRLRQLARLEEMKLRDEQDELLKEQAKLQA
FT                   LLSSEAKLKKLVRSELLKDAETYGDDRRSPIVERAEAKALTEHDLLPNEKVTVVLSEKG
FT                   WIRSAKGHEIDATGLSYKAGDGFKTSAAGRSNQSAVVIDSTGRSYSLATHTLPSARGQG
FT                   EPLTGRLTPPPGATFECVLMPEEDSLYVIASDAGYGFVVKGEDLQAKNKAGKALLSLPN
FT                   NAKVIAPRPVADREHNWLASVTTEGRLLIFKISDLPQLGKGKGNKIIGISGERVASREE
FT                   YVTDIAVLPEGATLVLQAGKRTLSLKADDLEHYKGERGRRGNKLPRGFQRVDALLVENL
FT                   N"
     MSDNLADSLD GVERRSLADF TENAYLNYSM YVIMDRALPH IGDGLKPVQR RIVYAMSELG        60
     LDADSKHKKS ARTVGDVLGK FHPHGDSACY EAMVLMAQPF SYRYTLVDGQ GNWGAPDDPK       120
     SFAAMRYTEA RLSRYSEVLL SELGQGTADW GPNFDGTLQE PLVLPARLPN ILLNGTTGIA       180
     VGMATDVPPH NLREVATACV RLLDEPKATV EQLCEHIQGP DYPTEAEIIT PRADLLKMYE       240
     TGKGSVRMRA VYHVEDGDII VTALPHQVSG AKVLEQIAAL MQAKPSKAPQ IADLRDESDH       300
     ENPCRIVIIP VNSRVDHEAL MQHLFASTEL ESTYRVNVNI IGLDGKPQLK NLRALLVEWL       360
     EFRVLTVRRR LQFRLDKVER RLHLLDGLLI AYLNLDEVIH IIRTEEHPKA KLIERFALSE       420
     IQADYILDTR LRQLARLEEM KLRDEQDELL KEQAKLQALL SSEAKLKKLV RSELLKDAET       480
     YGDDRRSPIV ERAEAKALTE HDLLPNEKVT VVLSEKGWIR SAKGHEIDAT GLSYKAGDGF       540
     KTSAAGRSNQ SAVVIDSTGR SYSLATHTLP SARGQGEPLT GRLTPPPGAT FECVLMPEED       600
     SLYVIASDAG YGFVVKGEDL QAKNKAGKAL LSLPNNAKVI APRPVADREH NWLASVTTEG       660
     RLLIFKISDL PQLGKGKGNK IIGISGERVA SREEYVTDIA VLPEGATLVL QAGKRTLSLK       720
     ADDLEHYKGE RGRRGNKLPR GFQRVDALLV ENLN                                   754
//

If you have problems or comments...

PBIL Back to PBIL home page