(data stored in ACNUC7421 zone)

EMBL: CP000094.PE503

CP000094.PE503       Location/Qualifiers
FT   CDS             complement(585425..586939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0505"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72249"
FT                   /db_xref="GOA:Q3KJ07"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ07"
FT                   /protein_id="ABA72249.1"
FT                   /translation="MNRPTPVKTDNFFLLIFRALRHRRVPIALRIASHNVILVALALVI
FT                   YACVMGLQFKQAMHEQADALGESLTTQTATSATELLVSNDILSLNVLLNNLTKNKLVAH
FT                   AAIYSVDNRILAESGQRPKHGLLGEAEGMYESKITFQDVTAGQLRISLDMDQFQQPMTI
FT                   SLQSMGILSAILLALSLALSLRLGRHISTPLLQLRVWLRRIDEYTPGIERQDEIGDLAR
FT                   QLHANYAPEPAEPEPEPEPEFEDDDIEPEFEVRNLRDPSFDESRPMAAQKPAPRHVVST
FT                   VEDDDDEDPFADLRDESLSEAAQPAVRRPTPSVPQHTAVLAVQLGSQEQLRRLPRARLE
FT                   ELQDRYRDCLDQAASLYQGEIETLNDGSTLMLFHTEDSGDDYLTNAICCGELLRALGHQ
FT                   LQIEVADSGITLQLQLGLTLGDELFGLSQIDLLLTDSAQDALALSQHSRNLLLVERKIG
FT                   DDALIRQRARIRPIASPEGACCVERLMEPYPSMLERQLARMHERRA"
     MNRPTPVKTD NFFLLIFRAL RHRRVPIALR IASHNVILVA LALVIYACVM GLQFKQAMHE        60
     QADALGESLT TQTATSATEL LVSNDILSLN VLLNNLTKNK LVAHAAIYSV DNRILAESGQ       120
     RPKHGLLGEA EGMYESKITF QDVTAGQLRI SLDMDQFQQP MTISLQSMGI LSAILLALSL       180
     ALSLRLGRHI STPLLQLRVW LRRIDEYTPG IERQDEIGDL ARQLHANYAP EPAEPEPEPE       240
     PEFEDDDIEP EFEVRNLRDP SFDESRPMAA QKPAPRHVVS TVEDDDDEDP FADLRDESLS       300
     EAAQPAVRRP TPSVPQHTAV LAVQLGSQEQ LRRLPRARLE ELQDRYRDCL DQAASLYQGE       360
     IETLNDGSTL MLFHTEDSGD DYLTNAICCG ELLRALGHQL QIEVADSGIT LQLQLGLTLG       420
     DELFGLSQID LLLTDSAQDA LALSQHSRNL LLVERKIGDD ALIRQRARIR PIASPEGACC       480
     VERLMEPYPS MLERQLARMH ERRA                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page