(data stored in ACNUC7421 zone)

EMBL: CP000094.PE51

CP000094.PE51        Location/Qualifiers
FT   CDS             complement(57242..58120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0051"
FT                   /product="putative endonuclease/exonuclease/phosphatase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABA71795"
FT                   /db_xref="GOA:Q3KKB1"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KKB1"
FT                   /protein_id="ABA71795.1"
FT                   /translation="MRRWGTERVVGLHEPQVNEHHLESTGLPADSRLRLLSFNIQVGIS
FT                   TERYRHYLTRSWQHLLPHPGRSSNLQKIGNLLGDFDLVALQEADGGSLRSGYVNQVEHL
FT                   AQLGAFPYWYQQLNRNLGRLAQHSNGVLSRLRPWAIEDHPLPGPKGRGAILVRFGEGPE
FT                   ALVVVMMHLALGARVRSMQLAYIRELIGGYKHQVLMGDMNTHASDLLQHSPLRDLGLLA
FT                   PQLEATFPSWRPQRCLDHILLSPTLTLEKVEVLAQPISDHLPVAVEIRLPGSLTADALP
FT                   ALSTALRGTPE"
     MRRWGTERVV GLHEPQVNEH HLESTGLPAD SRLRLLSFNI QVGISTERYR HYLTRSWQHL        60
     LPHPGRSSNL QKIGNLLGDF DLVALQEADG GSLRSGYVNQ VEHLAQLGAF PYWYQQLNRN       120
     LGRLAQHSNG VLSRLRPWAI EDHPLPGPKG RGAILVRFGE GPEALVVVMM HLALGARVRS       180
     MQLAYIRELI GGYKHQVLMG DMNTHASDLL QHSPLRDLGL LAPQLEATFP SWRPQRCLDH       240
     ILLSPTLTLE KVEVLAQPIS DHLPVAVEIR LPGSLTADAL PALSTALRGT PE               292
//

If you have problems or comments...

PBIL Back to PBIL home page