(data stored in ACNUC7421 zone)

EMBL: CP000094.PE510

CP000094.PE510       Location/Qualifiers
FT   CDS             594207..595058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0512"
FT                   /product="chemotaxis MotA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72256"
FT                   /db_xref="GOA:Q3KJ00"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KJ00"
FT                   /protein_id="ABA72256.1"
FT                   /translation="MAKIIGIIVVFASVLGGYVLSHGKIAALIQPFEVMIIGGAALGAF
FT                   LQANPGYMTMHVLKKSLSMFSSRFSHTFYLEVLGLIYEILNKSRREGMMAIEGDIEDAA
FT                   ASPIFAKYPAVLKDERMTAFICDYLRIMSSGNMAPHELEGLFDMELYSLKEDLEHPSHA
FT                   VNGIADAMPGFGIVAAVLGIVVTMASLGEGDQKSIGLHVGAALVGTFFGILAAYGFFGP
FT                   LAHSLAHDAKEELNVYEAIKASLVASASGMPPSLAVEFGRKVLYPAHRPSFAELEQAVR
FT                   GR"
     MAKIIGIIVV FASVLGGYVL SHGKIAALIQ PFEVMIIGGA ALGAFLQANP GYMTMHVLKK        60
     SLSMFSSRFS HTFYLEVLGL IYEILNKSRR EGMMAIEGDI EDAAASPIFA KYPAVLKDER       120
     MTAFICDYLR IMSSGNMAPH ELEGLFDMEL YSLKEDLEHP SHAVNGIADA MPGFGIVAAV       180
     LGIVVTMASL GEGDQKSIGL HVGAALVGTF FGILAAYGFF GPLAHSLAHD AKEELNVYEA       240
     IKASLVASAS GMPPSLAVEF GRKVLYPAHR PSFAELEQAV RGR                         283
//

If you have problems or comments...

PBIL Back to PBIL home page