(data stored in ACNUC7421 zone)

EMBL: CP000094.PE511

CP000094.PE511       Location/Qualifiers
FT   CDS             595062..596129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0513"
FT                   /product="chemotaxis MotB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72257"
FT                   /db_xref="GOA:Q3KIZ9"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ9"
FT                   /protein_id="ABA72257.1"
FT                   /translation="MENNQPIIIKRVKRIAGGHHGGAWKIAFADFATAMMAFFLVLWLL
FT                   STATPEQKIAIAGYFKDPVGFSESGTPYIIDLGGTPTLAPENTLNPEVKSQPQPDKVTV
FT                   DTEQVEGMAEQVEKERLELLLQELQNKVDENPQLQKFKDQILFEITPNGLRIQIMDAEN
FT                   RPMFDSGSARLKPYFEDILLAMADTIKAVPNKISISGHTDAKPYVGNGDFGNWELSANR
FT                   ANAARRALVAGSYPDSQVARVVGYASSALFDKENPFNPVNRRIDIVVLTKKAQAAIEGA
FT                   QGADPSKPADQGQNGAAPATPVDPNALPADQQPVPAHELRERLNLFDDPLPKPTEPGSA
FT                   APAPVPAAPAPAPKQ"
     MENNQPIIIK RVKRIAGGHH GGAWKIAFAD FATAMMAFFL VLWLLSTATP EQKIAIAGYF        60
     KDPVGFSESG TPYIIDLGGT PTLAPENTLN PEVKSQPQPD KVTVDTEQVE GMAEQVEKER       120
     LELLLQELQN KVDENPQLQK FKDQILFEIT PNGLRIQIMD AENRPMFDSG SARLKPYFED       180
     ILLAMADTIK AVPNKISISG HTDAKPYVGN GDFGNWELSA NRANAARRAL VAGSYPDSQV       240
     ARVVGYASSA LFDKENPFNP VNRRIDIVVL TKKAQAAIEG AQGADPSKPA DQGQNGAAPA       300
     TPVDPNALPA DQQPVPAHEL RERLNLFDDP LPKPTEPGSA APAPVPAAPA PAPKQ            355
//

If you have problems or comments...

PBIL Back to PBIL home page