(data stored in ACNUC7421 zone)

EMBL: CP000094.PE514

CP000094.PE514       Location/Qualifiers
FT   CDS             597950..598561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0516"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72260"
FT                   /db_xref="GOA:Q3KIZ6"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ6"
FT                   /protein_id="ABA72260.1"
FT                   /translation="MLLMLYLVAITAEAMTGAMSAGRRGMDWFGVVLIACVTALGGGSV
FT                   RDVLLGHYPLTWVKHPEYLVLTTVAAMITVFTARWMRHLRSLFLVLDAVGLVAFTLIGC
FT                   MTALEMGHGMLVASVSGVITGVFGGILRDIFCNDIPLIFRRELYASVSFAAAWCYMLCL
FT                   FLSVPSEQAILITLFGGFLLRLLAIRFHWEMPKFVYNDAP"
     MLLMLYLVAI TAEAMTGAMS AGRRGMDWFG VVLIACVTAL GGGSVRDVLL GHYPLTWVKH        60
     PEYLVLTTVA AMITVFTARW MRHLRSLFLV LDAVGLVAFT LIGCMTALEM GHGMLVASVS       120
     GVITGVFGGI LRDIFCNDIP LIFRRELYAS VSFAAAWCYM LCLFLSVPSE QAILITLFGG       180
     FLLRLLAIRF HWEMPKFVYN DAP                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page