(data stored in ACNUC7421 zone)

EMBL: CP000094.PE516

CP000094.PE516       Location/Qualifiers
FT   CDS             599686..601185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0518"
FT                   /product="putative carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72262"
FT                   /db_xref="GOA:Q3KIZ4"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ4"
FT                   /protein_id="ABA72262.1"
FT                   /translation="MPHTKDQLPDALYRAAQVRELDARLIAGGTPGFELMQRAAHATWR
FT                   ALVRQWPAANEMTVFAGHGNNAGDGYLVAALAHRAGWQVQVLAVGEPQRLKGDAAVAHA
FT                   EAVAEGVSIAAWDLSCELRGIVVDALLGTGLNGEVREPYAAAIAAINASGLPVVAVDIP
FT                   SGLCADTGHALGDAVHADLTVTFIGLKLGLFTGAAADHVGELRFNDLQATAENFSDIPA
FT                   AAQRLSAINLPRLAARAPAAHKGRFGHVLLIGGDHGFGGAILLSTESALRSGAGMVSVA
FT                   TRPEHVPAALSRVPEAMVLGTSSANQLMGLLEKVSVLVVGPGLGQAAWGRALLSAAANA
FT                   SLPQVWDADALNLLARGFVSLPKDCVITPHPGEAARLLGISTAEVQADRPAAALALSKK
FT                   YTAVVVLKGAGSLIAHPDGRLALCHQGHPAMATAGLGDVLAGLIGALLAQGMDGFDAAC
FT                   LAVWLHASAGAQQGKFGRGLAASDLIPAIRQLLEEHAPCLK"
     MPHTKDQLPD ALYRAAQVRE LDARLIAGGT PGFELMQRAA HATWRALVRQ WPAANEMTVF        60
     AGHGNNAGDG YLVAALAHRA GWQVQVLAVG EPQRLKGDAA VAHAEAVAEG VSIAAWDLSC       120
     ELRGIVVDAL LGTGLNGEVR EPYAAAIAAI NASGLPVVAV DIPSGLCADT GHALGDAVHA       180
     DLTVTFIGLK LGLFTGAAAD HVGELRFNDL QATAENFSDI PAAAQRLSAI NLPRLAARAP       240
     AAHKGRFGHV LLIGGDHGFG GAILLSTESA LRSGAGMVSV ATRPEHVPAA LSRVPEAMVL       300
     GTSSANQLMG LLEKVSVLVV GPGLGQAAWG RALLSAAANA SLPQVWDADA LNLLARGFVS       360
     LPKDCVITPH PGEAARLLGI STAEVQADRP AAALALSKKY TAVVVLKGAG SLIAHPDGRL       420
     ALCHQGHPAM ATAGLGDVLA GLIGALLAQG MDGFDAACLA VWLHASAGAQ QGKFGRGLAA       480
     SDLIPAIRQL LEEHAPCLK                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page