(data stored in ACNUC7421 zone)

EMBL: CP000094.PE517

CP000094.PE517       Location/Qualifiers
FT   CDS             601212..601643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pfl01_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pfl01_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABA72263"
FT                   /db_xref="GOA:Q3KIZ3"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KIZ3"
FT                   /protein_id="ABA72263.1"
FT                   /translation="MSDFGARIARITQGHGLIFLEGNLGMGKTTLSRGIIRGLGHVGAV
FT                   KSPTFTLVEPYEIGDVRAFHFDLYRLVDPEELEFLGIRDYFEDDALCLIEWPDKGAGFL
FT                   PKPDLTITISPQDSGRSLTILSQGSRGEAWCAALALETN"
     MSDFGARIAR ITQGHGLIFL EGNLGMGKTT LSRGIIRGLG HVGAVKSPTF TLVEPYEIGD        60
     VRAFHFDLYR LVDPEELEFL GIRDYFEDDA LCLIEWPDKG AGFLPKPDLT ITISPQDSGR       120
     SLTILSQGSR GEAWCAALAL ETN                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page